PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009591628.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 542aa    MW: 58831 Da    PI: 6.7392
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009591628.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.32.4e-31187244260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers  +++++ei+Y+g+H+h+k
  XP_009591628.1 187 DDGYNWRKYGQKLVKGSEFPRSYYKCTYPNCEVKKIFERSP-EGQITEIVYKGSHDHPK 244
                     8****************************************.***************85 PP

2WRKY106.31.5e-33358416159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  XP_009591628.1 358 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 416
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-26177245IPR003657WRKY domain
PROSITE profilePS5081122.435181245IPR003657WRKY domain
SuperFamilySSF1182902.09E-24183245IPR003657WRKY domain
SMARTSM007743.4E-33186244IPR003657WRKY domain
PfamPF031068.1E-24187243IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-37343418IPR003657WRKY domain
SuperFamilySSF1182902.09E-29350418IPR003657WRKY domain
PROSITE profilePS5081138.825353418IPR003657WRKY domain
SMARTSM007743.1E-39358417IPR003657WRKY domain
PfamPF031063.2E-26359416IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MSLRSSNSKS QAPMLPPLDR TAVEAEPSPT TGSFSKFQLM QGSSGSAALS FMRSCSSGNA  60
YGETTGEFEF KFAIGSSSTS GSLAKEAATF AGLNQQQSEP LNQIQDRYLF QSFAPSALVR  120
SEMPNSKEVS LPAPVSLDAS SISTAAADAA AIDNEEISQR GHSNPSSQGS HADNRDVSSI  180
TAERSSDDGY NWRKYGQKLV KGSEFPRSYY KCTYPNCEVK KIFERSPEGQ ITEIVYKGSH  240
DHPKPQPSRR FTPGALTSIQ EDRSEKEASF TGQEDKFNTN AYTSNIEPSS TPVSPRLAED  300
DGLEGTVSQL QSANDQLDED DPFAKRRKMD GGMDITPVVK PIREPRVVVQ TVSEVDILDD  360
GYRWRKYGQK VVRGNPNPRS YYKCTNAGCP VRKHVERASH DPKAVITTYE GKHNHDVPTA  420
RNHSHEMAGS APVTGSSRVR AEENGSISLD LGVGIGYGME NRSNGQLHTR PAENVRNQVQ  480
VSSSSMMVVQ PGAVAACYGI VNGGMSRFGS IDNRIQGTGF ESLPLQPSTQ CPQNYGRIIL  540
GP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-37187418877Probable WRKY transcription factor 4
2lex_A1e-37187418877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7111310.0AB711131.1 Nicotiana benthamiana NbWRKY10 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591628.10.0PREDICTED: probable WRKY transcription factor 20 isoform X2
TrEMBLA0A0P0UVU30.0A0A0P0UVU3_NICBE; Transcription factor
STRINGPGSC0003DMT4000766700.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.11e-125WRKY family protein